Lineage for d2bcja1 (2bcj A:28-185)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719790Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2719791Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2719792Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 2719797Protein G-protein coupled receptor kinase 2, N-terminal domain [89090] (1 species)
  7. 2719798Species Cow (Bos taurus) [TaxId:9913] [89091] (6 PDB entries)
  8. 2719803Domain d2bcja1: 2bcj A:28-185 [128286]
    Other proteins in same PDB: d2bcja2, d2bcja3, d2bcjb_, d2bcjg_, d2bcjq1, d2bcjq2
    automated match to d1omwa1
    complexed with alf, gdp, mg

Details for d2bcja1

PDB Entry: 2bcj (more details), 3.06 Å

PDB Description: crystal structure of g protein-coupled receptor kinase 2 in complex with galpha-q and gbetagamma subunits
PDB Compounds: (A:) G-protein-coupled receptor kinase 2

SCOPe Domain Sequences for d2bcja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bcja1 a.91.1.1 (A:28-185) G-protein coupled receptor kinase 2, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
askkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclkhleeakplvefye
eikkyekleteeerlvcsreifdtyimkellacshpfsksaiehvqghlvkkqvppdlfq
pyieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d2bcja1:

Click to download the PDB-style file with coordinates for d2bcja1.
(The format of our PDB-style files is described here.)

Timeline for d2bcja1: