SCOPe 2.08: Domain d2bcjg_: 2bcj G:

Lineage for d2bcjg_ (2bcj G:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (72 PDB entries)

8. Domain d2bcjg_: 2bcj G: [128290]
   Other proteins in same PDB: d2bcja1, d2bcja2, d2bcja3, d2bcjb_, d2bcjq1, d2bcjq2
   automated match to d2trcg_
   complexed with alf, gdp, mg

Details for d2bcjg_

PDB Entry: 2bcj, 3.06 Å

PDB Description: crystal structure of g protein-coupled receptor kinase 2 in complex with galpha-q and gbetagamma subunits

PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d2bcjg_:

Sequence; same for both SEQRES and ATOM records:

>d2bcjg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
nntasiaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfre
kkff

Timeline for d2bcjg_:

• d2bcjg_ first appeared in SCOP 1.73, called d2bcjg1
  
• d2bcjg_ appears in SCOPe 2.07