Lineage for d2bcja3 (2bcj A:186-549)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543768Protein G-protein coupled receptor kinase 2 [90034] (1 species)
    AGC group; GRKs subfamily; serine/threonine kinase
  7. 2543769Species Cow (Bos taurus) [TaxId:9913] [90035] (10 PDB entries)
  8. 2543778Domain d2bcja3: 2bcj A:186-549 [128288]
    Other proteins in same PDB: d2bcja1, d2bcja2, d2bcjb_, d2bcjg_, d2bcjq1, d2bcjq2
    automated match to d1omwa3
    complexed with alf, gdp, mg

Details for d2bcja3

PDB Entry: 2bcj (more details), 3.06 Å

PDB Description: crystal structure of g protein-coupled receptor kinase 2 in complex with galpha-q and gbetagamma subunits
PDB Compounds: (A:) G-protein-coupled receptor kinase 2

SCOPe Domain Sequences for d2bcja3:

Sequence, based on SEQRES records: (download)

>d2bcja3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgevnaadafdi
gsfdeedtkgiklldsdqelyrnfpltiserwqqevaetvfdtinaetdrlearkktknk
qlgh

Sequence, based on observed residues (ATOM records): (download)

>d2bcja3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]}
ltmndfsvhriigrggfgevygcrkadtgkmyamkcldkkrikmkqgetlalnerimlsl
vstgdcpfivcmsyafhtpdklsfildlmnggdlhyhlsqhgvfseadmrfyaaeiilgl
ehmhnrfvvyrdlkpanilldehghvrisdlglacdfskkkphasvgthgymapevlqkg
vaydssadwfslgcmlfkllrghspfrqhktkdkheidrmtltmavelpdsfspelrsll
egllqrdvnrrlgclgrgaqevkespffrsldwqmvflqkyppplipprgdtkgikllds
dqelyrnfpltiserwqqevaetvfdtinaetdrlearkktknkqlgh

SCOPe Domain Coordinates for d2bcja3:

Click to download the PDB-style file with coordinates for d2bcja3.
(The format of our PDB-style files is described here.)

Timeline for d2bcja3: