SCOP 1.73: Domain d2bcjg1: 2bcj G:8-67

Lineage for d2bcjg1 (2bcj G:8-67)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (11 PDB entries)

8. Domain d2bcjg1: 2bcj G:8-67 [128290]
   Other proteins in same PDB: d2bcja1, d2bcja2, d2bcja3, d2bcjb1, d2bcjq1, d2bcjq2
   automatically matched to d1omwg_
   complexed with ace, alf, gdp, mg; mutant

Details for d2bcjg1

PDB Entry: 2bcj, 3.06 Å

PDB Description: crystal structure of g protein-coupled receptor kinase 2 in complex with galpha-q and gbetagamma subunits

PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) gamma-2 subunit

SCOP Domain Sequences for d2bcjg1:

Sequence; same for both SEQRES and ATOM records:

>d2bcjg1 a.137.3.1 (G:8-67) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkff

Timeline for d2bcjg1:

• d2bcjg1 is new in SCOP 1.73
  
• d2bcjg1 appears in SCOP 1.75
  
• d2bcjg1 appears in the current release, SCOPe 2.08, called d2bcjg_