Lineage for d2b9nw1 (2b9n W:2-110)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860696Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 860697Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 860698Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 860699Protein Ribosomal protein L22 [54845] (5 species)
  7. 860796Species Thermus aquaticus, subsp. Thermus thermophilus [TaxId:271] [54846] (6 PDB entries)
  8. 860802Domain d2b9nw1: 2b9n W:2-110 [128159]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nx1, d2b9ny1, d2b9nz1
    automatically matched to d1bxea_

Details for d2b9nw1

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (W:) 50S ribosomal protein L22

SCOP Domain Sequences for d2b9nw1:

Sequence, based on SEQRES records: (download)

>d2b9nw1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]}
eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

Sequence, based on observed residues (ATOM records): (download)

>d2b9nw1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]}
eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
hdledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

SCOP Domain Coordinates for d2b9nw1:

Click to download the PDB-style file with coordinates for d2b9nw1.
(The format of our PDB-style files is described here.)

Timeline for d2b9nw1: