Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) some topological similarity to prokaryotic ribosomal protein L17 |
Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
Protein Ribosomal protein L22 [54845] (5 species) |
Species Thermus aquaticus, subsp. Thermus thermophilus [TaxId:271] [54846] (6 PDB entries) |
Domain d2b9nw1: 2b9n W:2-110 [128159] Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nx1, d2b9ny1, d2b9nz1 automatically matched to d1bxea_ |
PDB Entry: 2b9n (more details), 6.76 Å
SCOP Domain Sequences for d2b9nw1:
Sequence, based on SEQRES records: (download)
>d2b9nw1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]} eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
>d2b9nw1 d.55.1.1 (W:2-110) Ribosomal protein L22 {Thermus aquaticus, subsp. Thermus thermophilus [TaxId: 271]} eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn hdledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
Timeline for d2b9nw1: