SCOP 1.75: Domain d2b9n51: 2b9n 5:2-59

Lineage for d2b9n51 (2b9n 5:2-59)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
   Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail

6. Protein Ribosomal protein L32p [144201] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [161178] (10 PDB entries)
   Uniprot P49228 2-59

8. Domain d2b9n51: 2b9n 5:2-59 [144969]
   Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1
   automatically matched to 2ZJR Z:2-59

Details for d2b9n51

PDB Entry: 2b9n, 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.

PDB Compounds: (5:) 50S ribosomal protein L32

SCOP Domain Sequences for d2b9n51:

Sequence; same for both SEQRES and ATOM records:

>d2b9n51 g.41.8.5 (5:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

Timeline for d2b9n51:

• d2b9n51 is new in SCOP 1.75
  
• d2b9n51 appears in SCOPe 2.01
  
• d2b9n51 appears in the current release, SCOPe 2.08