Lineage for d2b9n01 (2b9n 0:2-85)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810794Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 810963Superfamily b.84.4: Ribosomal L27 protein-like [110324] (2 families) (S)
    rudiment single hybrid fold with a permuted topology
  5. 810964Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
    Pfam PF01016
  6. 810965Protein Ribosomal protein L27 [110326] (3 species)
  7. 810966Species Deinococcus radiodurans [TaxId:1299] [159323] (11 PDB entries)
    Uniprot Q9RY65 2-85
  8. 810976Domain d2b9n01: 2b9n 0:2-85 [144968]
    Other proteins in same PDB: d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1
    automatically matched to 2ZJR T:2-85

Details for d2b9n01

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (0:) 50S ribosomal protein L27

SCOP Domain Sequences for d2b9n01:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9n01 b.84.4.1 (0:2-85) Ribosomal protein L27 {Deinococcus radiodurans [TaxId: 1299]}
ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
lsdgkvvfinkgkgarfisieaaq

SCOP Domain Coordinates for d2b9n01:

Click to download the PDB-style file with coordinates for d2b9n01.
(The format of our PDB-style files is described here.)

Timeline for d2b9n01: