![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.39: Ribosomal protein L14 [50192] (1 superfamily) barrel, closed; n=5, S=8, meander |
![]() | Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) ![]() |
![]() | Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein) |
![]() | Protein Ribosomal protein L14 [50195] (5 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [50196] (5 PDB entries) |
![]() | Domain d2b9no1: 2b9n O:1-122 [128156] Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1 automatically matched to d1whi__ |
PDB Entry: 2b9n (more details), 6.76 Å
SCOP Domain Sequences for d2b9no1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9no1 b.39.1.1 (O:1-122) Ribosomal protein L14 {Bacillus stearothermophilus [TaxId: 1422]} miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape vi
Timeline for d2b9no1: