Lineage for d2b9n81 (2b9n 8:2-64)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882221Fold d.301: L35p-like [143033] (1 superfamily)
    core: alpha-beta(3)-alpha; 2layers a/b
  4. 882222Superfamily d.301.1: L35p-like [143034] (1 family) (S)
  5. 882223Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
    Pfam PF01632
  6. 882224Protein Ribosomal protein L35p [143036] (3 species)
  7. 882225Species Deinococcus radiodurans [TaxId:1299] [160056] (10 PDB entries)
    Uniprot Q9RSW6 2-64
  8. 882234Domain d2b9n81: 2b9n 8:2-64 [144971]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1
    automatically matched to 2ZJR 3:2-64

Details for d2b9n81

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (8:) 50S ribosomal protein L35

SCOP Domain Sequences for d2b9n81:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9n81 d.301.1.1 (8:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

SCOP Domain Coordinates for d2b9n81:

Click to download the PDB-style file with coordinates for d2b9n81.
(The format of our PDB-style files is described here.)

Timeline for d2b9n81: