Lineage for d2b9nv1 (2b9n V:5-98)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 813866Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 813867Superfamily b.155.1: L21p-like [141091] (1 family) (S)
  5. 813868Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 813869Protein Ribosomal protein L21p [141093] (3 species)
  7. 813870Species Deinococcus radiodurans [TaxId:1299] [158938] (10 PDB entries)
    Uniprot Q9RY64 5-98
  8. 813879Domain d2b9nv1: 2b9n V:5-98 [144974]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1
    automatically matched to 2ZJR O:5-98

Details for d2b9nv1

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (V:) 50S ribosomal protein L21

SCOP Domain Sequences for d2b9nv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9nv1 b.155.1.1 (V:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

SCOP Domain Coordinates for d2b9nv1:

Click to download the PDB-style file with coordinates for d2b9nv1.
(The format of our PDB-style files is described here.)

Timeline for d2b9nv1: