Lineage for d2b4yd_ (2b4y D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107255Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2107256Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2107522Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2107568Protein NAD-dependent deacetylase sirtuin-5 [142128] (1 species)
  7. 2107569Species Human (Homo sapiens) [TaxId:9606] [142129] (4 PDB entries)
    Uniprot Q9NXA8 36-302
  8. 2107573Domain d2b4yd_: 2b4y D: [127871]
    automated match to d2b4ya1
    complexed with apr, epe, zn

Details for d2b4yd_

PDB Entry: 2b4y (more details), 1.9 Å

PDB Description: Crystal Structure of Human Sirtuin homolog 5
PDB Compounds: (D:) NAD-dependent deacetylase sirtuin-5

SCOPe Domain Sequences for d2b4yd_:

Sequence, based on SEQRES records: (download)

>d2b4yd_ c.31.1.5 (D:) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]}
psssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplafahnp
srvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknll
eihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggl
lrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefn
tettpatnrfrfhfqgpcgttlpeala

Sequence, based on observed residues (ATOM records): (download)

>d2b4yd_ c.31.1.5 (D:) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]}
psssmadfrkffakakhiviisgagvsaesgvptfywrkwqaqdlatplafahnpsrvwe
fyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknlleihgs
lfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggllrphv
vwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefntettp
atnrfrfhfqgpcgttlpeala

SCOPe Domain Coordinates for d2b4yd_:

Click to download the PDB-style file with coordinates for d2b4yd_.
(The format of our PDB-style files is described here.)

Timeline for d2b4yd_: