PDB entry 2b4y

View 2b4y on RCSB PDB site
Description: Crystal Structure of Human Sirtuin homolog 5
Class: hydrolase
Keywords: histone deacetylase, Structural Genomics, Structural Genomics Consortium, SGC, hydrolase
Deposited on 2005-09-27, released 2006-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.185
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase sirtuin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT5, SIR2L5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NXA8 (Start-270)
      • modified residue (8)
      • modified residue (77)
      • modified residue (227)
    Domains in SCOPe 2.08: d2b4ya1
  • Chain 'B':
    Compound: NAD-dependent deacetylase sirtuin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT5, SIR2L5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NXA8 (Start-270)
      • modified residue (8)
      • modified residue (77)
      • modified residue (227)
    Domains in SCOPe 2.08: d2b4yb_
  • Chain 'C':
    Compound: NAD-dependent deacetylase sirtuin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT5, SIR2L5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NXA8 (Start-270)
      • modified residue (8)
      • modified residue (77)
      • modified residue (227)
    Domains in SCOPe 2.08: d2b4yc_
  • Chain 'D':
    Compound: NAD-dependent deacetylase sirtuin-5
    Species: Homo sapiens [TaxId:9606]
    Gene: SIRT5, SIR2L5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NXA8 (Start-270)
      • modified residue (8)
      • modified residue (77)
      • modified residue (227)
    Domains in SCOPe 2.08: d2b4yd_
  • Heterogens: ZN, APR, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b4yA (A:)
    gsarpsssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplaf
    ahnpsrvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagt
    knlleihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeag
    cggllrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpv
    aefntettpatnrfrfhfqgpcgttlpeala
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4yA (A:)
    psssmadfrkffakakhiviisgagvsaesgvgywrkwqaqdlatplafahnpsrvwefy
    hyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknlleihgslf
    ktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggllrphvvw
    fgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefntettpat
    nrfrfhfqgpcgttlpeala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b4yB (B:)
    gsarpsssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplaf
    ahnpsrvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagt
    knlleihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeag
    cggllrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpv
    aefntettpatnrfrfhfqgpcgttlpeala
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4yB (B:)
    psssmadfrkffakakhiviisgagvsaesgvptgywrkwqaqdlatplafahnpsrvwe
    fyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknlleihgs
    lfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggllrphv
    vwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefntettp
    atnrfrfhfqgpcgttlpeala
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b4yC (C:)
    gsarpsssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplaf
    ahnpsrvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagt
    knlleihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeag
    cggllrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpv
    aefntettpatnrfrfhfqgpcgttlpeala
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4yC (C:)
    psssmadfrkffakakhiviisgagvsaesgvptfrywrkwqaqdlatplafahnpsrvw
    efyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknlleihg
    slfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggllrph
    vvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefntett
    patnrfrfhfqgpcgttlpeala
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2b4yD (D:)
    gsarpsssmadfrkffakakhiviisgagvsaesgvptfrgaggywrkwqaqdlatplaf
    ahnpsrvwefyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagt
    knlleihgslfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeag
    cggllrphvvwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpv
    aefntettpatnrfrfhfqgpcgttlpeala
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4yD (D:)
    psssmadfrkffakakhiviisgagvsaesgvptfywrkwqaqdlatplafahnpsrvwe
    fyhyrrevmgskepnaghraiaecetrlgkqgrrvvvitqnidelhrkagtknlleihgs
    lfktrctscgvvaenykspicpalsgkgapepgtqdasipveklprceeagcggllrphv
    vwfgenldpaileevdrelahcdlclvvgtssvvypaamfapqvaargvpvaefntettp
    atnrfrfhfqgpcgttlpeala