Lineage for d2axue2 (2axu E:71-304)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726841Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)
  6. 2726842Protein PrgX [140849] (1 species)
  7. 2726843Species Enterococcus faecalis [TaxId:1351] [140850] (4 PDB entries)
    Uniprot Q04114 70-287! Uniprot Q04114 71-301
  8. 2726860Domain d2axue2: 2axu E:71-304 [127509]
    Other proteins in same PDB: d2axua1, d2axub1, d2axuc1, d2axud1, d2axue1, d2axuf1, d2axug1, d2axuh1, d2axui1, d2axuj1, d2axuk1, d2axul1
    automated match to d2aw6a2

Details for d2axue2

PDB Entry: 2axu (more details), 2.9 Å

PDB Description: Structure of PrgX
PDB Compounds: (E:) PrgX

SCOPe Domain Sequences for d2axue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axue2 a.118.8.4 (E:71-304) PrgX {Enterococcus faecalis [TaxId: 1351]}
svnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievptf
nktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlti
qtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdkn
idsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyva

SCOPe Domain Coordinates for d2axue2:

Click to download the PDB-style file with coordinates for d2axue2.
(The format of our PDB-style files is described here.)

Timeline for d2axue2: