Class a: All alpha proteins [46456] (290 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein) Part of Pfam PF01381 |
Protein PrgX [140527] (1 species) possibly involved in pheromone-inducible conjugation |
Species Enterococcus faecalis [TaxId:1351] [140528] (4 PDB entries) Uniprot Q04114 1-69! Uniprot Q04114 2-66 |
Domain d2axuc1: 2axu C:3-68 [127504] Other proteins in same PDB: d2axua2, d2axub2, d2axuc2, d2axud2, d2axue2, d2axuf2, d2axug2, d2axuh2, d2axui2, d2axuj2, d2axuk2, d2axul2 automated match to d2aw6a1 |
PDB Entry: 2axu (more details), 2.9 Å
SCOPe Domain Sequences for d2axuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axuc1 a.35.1.11 (C:3-68) PrgX {Enterococcus faecalis [TaxId: 1351]} kigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeil nragmn
Timeline for d2axuc1: