![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins) |
![]() | Protein PrgX [140849] (1 species) |
![]() | Species Enterococcus faecalis [TaxId:1351] [140850] (4 PDB entries) Uniprot Q04114 70-287! Uniprot Q04114 71-301 |
![]() | Domain d2axuc2: 2axu C:71-303 [127505] Other proteins in same PDB: d2axua1, d2axub1, d2axuc1, d2axud1, d2axue1, d2axuf1, d2axug1, d2axuh1, d2axui1, d2axuj1, d2axuk1, d2axul1 automated match to d2aw6a2 |
PDB Entry: 2axu (more details), 2.9 Å
SCOPe Domain Sequences for d2axuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axuc2 a.118.8.4 (C:71-303) PrgX {Enterococcus faecalis [TaxId: 1351]} svnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievptf nktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlti qtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdkn idsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyv
Timeline for d2axuc2: