SCOPe 2.08: Domain d2axuh2: 2axu H:71-302

Lineage for d2axuh2 (2axu H:71-302)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.8: TPR-like [48452] (11 families)
Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)
Protein PrgX [140849] (1 species)
Species Enterococcus faecalis [TaxId:1351] [140850] (4 PDB entries)
Uniprot Q04114 70-287! Uniprot Q04114 71-301
Domain d2axuh2: 2axu H:71-302 [127515]
Other proteins in same PDB: d2axua1, d2axub1, d2axuc1, d2axud1, d2axue1, d2axuf1, d2axug1, d2axuh1, d2axui1, d2axuj1, d2axuk1, d2axul1
automated match to d2aw6a2

Details for d2axuh2

PDB Entry: 2axu (more details), 2.9 Å

PDB Description: Structure of PrgX

PDB Compounds: (H:) PrgX

SCOPe Domain Sequences for d2axuh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axuh2 a.118.8.4 (H:71-302) PrgX {Enterococcus faecalis [TaxId: 1351]}
svnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievptf
nktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlti
qtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdkn
idsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyeny

SCOPe Domain Coordinates for d2axuh2:

Click to download the PDB-style file with coordinates for d2axuh2.
(The format of our PDB-style files is described here.)

Timeline for d2axuh2: