SCOPe 2.08: Domain d2axuk1: 2axu K:4-68

Lineage for d2axuk1 (2axu K:4-68)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
   Part of Pfam PF01381

6. Protein PrgX [140527] (1 species)
   possibly involved in pheromone-inducible conjugation

7. Species Enterococcus faecalis [TaxId:1351] [140528] (4 PDB entries)
   Uniprot Q04114 1-69! Uniprot Q04114 2-66

8. Domain d2axuk1: 2axu K:4-68 [127520]
   Other proteins in same PDB: d2axua2, d2axub2, d2axuc2, d2axud2, d2axue2, d2axuf2, d2axug2, d2axuh2, d2axui2, d2axuj2, d2axuk2, d2axul2
   automated match to d2aw6a1

Details for d2axuk1

PDB Entry: 2axu, 2.9 Å

PDB Description: Structure of PrgX

PDB Compounds: (K:) PrgX

SCOPe Domain Sequences for d2axuk1:

Sequence; same for both SEQRES and ATOM records:

>d2axuk1 a.35.1.11 (K:4-68) PrgX {Enterococcus faecalis [TaxId: 1351]}
igsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffeiln
ragmn

Timeline for d2axuk1:

• d2axuk1 first appeared in SCOP 1.73
  
• d2axuk1 appears in SCOPe 2.07