Lineage for d2a5ya_ (2a5y A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021485Protein automated matches [190236] (3 species)
    not a true protein
  7. 3021539Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255025] (1 PDB entry)
  8. 3021540Domain d2a5ya_: 2a5y A: [126183]
    Other proteins in same PDB: d2a5yb1, d2a5yb2, d2a5yb3, d2a5yc1, d2a5yc2
    automated match to d1ohua_
    complexed with atp, mg

Details for d2a5ya_

PDB Entry: 2a5y (more details), 2.6 Å

PDB Description: structure of a ced-4/ced-9 complex
PDB Compounds: (A:) Apoptosis regulator ced-9

SCOPe Domain Sequences for d2a5ya_:

Sequence, based on SEQRES records: (download)

>d2a5ya_ f.1.4.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dgkindweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekk
haenfetfseqllavprisfslyqdvvrtvgnaqtdqspmsygrliglisfggfvaakmm
esvelqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeae

Sequence, based on observed residues (ATOM records): (download)

>d2a5ya_ f.1.4.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dgkindweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekk
haenfetfseqllavprisfslyqdvvrtvgnaqqspmsygrliglisfggfvaakmmes
velqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeae

SCOPe Domain Coordinates for d2a5ya_:

Click to download the PDB-style file with coordinates for d2a5ya_.
(The format of our PDB-style files is described here.)

Timeline for d2a5ya_: