SCOPe 2.08: Domain d2a5ya_: 2a5y A:

Lineage for d2a5ya_ (2a5y A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255025] (1 PDB entry)

8. Domain d2a5ya_: 2a5y A: [126183]
   Other proteins in same PDB: d2a5yb1, d2a5yb2, d2a5yb3, d2a5yc1, d2a5yc2
   automated match to d1ohua_
   complexed with atp, mg

Details for d2a5ya_

PDB Entry: 2a5y, 2.6 Å

PDB Description: structure of a ced-4/ced-9 complex

PDB Compounds: (A:) Apoptosis regulator ced-9

SCOPe Domain Sequences for d2a5ya_:

Sequence, based on SEQRES records:

>d2a5ya_ f.1.4.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dgkindweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekk
haenfetfseqllavprisfslyqdvvrtvgnaqtdqspmsygrliglisfggfvaakmm
esvelqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeae

Sequence, based on observed residues (ATOM records):

>d2a5ya_ f.1.4.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dgkindweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekk
haenfetfseqllavprisfslyqdvvrtvgnaqqspmsygrliglisfggfvaakmmes
velqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeae

Timeline for d2a5ya_:

• d2a5ya_ first appeared in SCOP 1.73, called d2a5ya1
  
• d2a5ya_ appears in SCOPe 2.07