SCOPe 2.08: Domain d2a5yb2: 2a5y B:1-108

Lineage for d2a5yb2 (2a5y B:1-108)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins)

6. Protein Cell death protein 4, CED-4 [158663] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [158664] (1 PDB entry)
   Uniprot P30429 1-108

8. Domain d2a5yb2: 2a5y B:1-108 [144787]
   Other proteins in same PDB: d2a5ya_, d2a5yb1, d2a5yb3, d2a5yc1, d2a5yc2
   complexed with atp, mg

Details for d2a5yb2

PDB Entry: 2a5y, 2.6 Å

PDB Description: structure of a ced-4/ced-9 complex

PDB Compounds: (B:) ced-4

SCOPe Domain Sequences for d2a5yb2:

Sequence; same for both SEQRES and ATOM records:

>d2a5yb2 a.77.1.3 (B:1-108) Cell death protein 4, CED-4 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mlceiecralstahtrlihdfeprdaltylegkniftedhseliskmstrlerianflri
yrrqaselgplidffnynnqshladfledyidfainepdllrpvviap

Timeline for d2a5yb2:

• d2a5yb2 first appeared in SCOP 1.75
  
• d2a5yb2 appears in SCOPe 2.07