SCOPe 2.08: Domain d2a5yc2: 2a5y C:386-543

Lineage for d2a5yc2 (2a5y C:386-543)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.80: CED-4 C-terminal domain-like [158326] (1 protein)
   similar domain architecture to AAA+ helicases

6. Protein Cell death protein 4, CED-4 [158327] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [158328] (1 PDB entry)
   Uniprot P30429 386-543

8. Domain d2a5yc2: 2a5y C:386-543 [197732]
   Other proteins in same PDB: d2a5ya_, d2a5yb2, d2a5yb3, d2a5yc1
   automated match to d2a5yb1
   complexed with atp, mg

Details for d2a5yc2

PDB Entry: 2a5y, 2.6 Å

PDB Description: structure of a ced-4/ced-9 complex

PDB Compounds: (C:) ced-4

SCOPe Domain Sequences for d2a5yc2:

Sequence, based on SEQRES records:

>d2a5yc2 a.4.5.80 (C:386-543) Cell death protein 4, CED-4 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
sdedrsalafavvmppgvdipvklwscvipvdicsneeeqlddevadrlkrlskrgalls
gkrmpvltfkidhiihmflkhvvdaqtiangisileqrlleignnnvsvperhipshfqk
frrssasemypktteetvirpedfpkfmqlhqkfydsl

Sequence, based on observed residues (ATOM records):

>d2a5yc2 a.4.5.80 (C:386-543) Cell death protein 4, CED-4 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
sdedrsalafavvmppgvdipvklwscviddevadrlkrlskrgallsgkrmpvltfkid
hiihmflkhvvdaqtiangisileqmqlhqkfydsl

Timeline for d2a5yc2:

• d2a5yc2 first appeared in SCOPe 2.03
  
• d2a5yc2 appears in SCOPe 2.07