Lineage for d1zlag_ (1zla G:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. Protein Histone H2A [47115] (7 species)
  7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (37 PDB entries)
  8. Domain d1zlag_: 1zla G: [125246]
    Other proteins in same PDB: d1zlaa_, d1zlab_, d1zlad_, d1zlae_, d1zlaf_, d1zlah_
    automated match to d1kx5c_
    protein/DNA complex

Details for d1zlag_

PDB Entry: 1zla (more details), 2.9 Å

PDB Description: x-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
PDB Compounds: (G:) Xenopus laevis-like histone H2A

SCOPe Domain Sequences for d1zlag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlag_ a.22.1.1 (G:) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnwerdn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk

SCOPe Domain Coordinates for d1zlag_ are not available.

Timeline for d1zlag_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1zlaa_, d1zlab_, d1zlac1, d1zlad_, d1zlae_, d1zlaf_, d1zlah_