Lineage for d1zlaa_ (1zla A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698296Protein Histone H3 [47122] (6 species)
  7. 2698297Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (41 PDB entries)
  8. 2698369Domain d1zlaa_: 1zla A: [125240]
    Other proteins in same PDB: d1zlab_, d1zlac1, d1zlad_, d1zlaf_, d1zlag_, d1zlah_
    automated match to d1kx5a_
    protein/DNA complex

Details for d1zlaa_

PDB Entry: 1zla (more details), 2.9 Å

PDB Description: x-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
PDB Compounds: (A:) histone h3

SCOPe Domain Sequences for d1zlaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlaa_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvhimpkdiqlarrirgera

SCOPe Domain Coordinates for d1zlaa_:

Click to download the PDB-style file with coordinates for d1zlaa_.
(The format of our PDB-style files is described here.)

Timeline for d1zlaa_: