Lineage for d1zlac1 (1zla C:814-920)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698057Protein Histone H2A [47115] (7 species)
  7. 2698058Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (37 PDB entries)
  8. 2698131Domain d1zlac1: 1zla C:814-920 [125242]
    Other proteins in same PDB: d1zlaa_, d1zlab_, d1zlad_, d1zlae_, d1zlaf_, d1zlah_
    protein/DNA complex

Details for d1zlac1

PDB Entry: 1zla (more details), 2.9 Å

PDB Description: x-ray structure of a kaposi's sarcoma herpesvirus lana peptide bound to the nucleosomal core
PDB Compounds: (C:) Xenopus laevis-like histone H2A

SCOPe Domain Sequences for d1zlac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlac1 a.22.1.1 (C:814-920) Histone H2A {African clawed frog (Xenopus laevis) [TaxId: 8355]}
aktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnwerdn
kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt

SCOPe Domain Coordinates for d1zlac1:

Click to download the PDB-style file with coordinates for d1zlac1.
(The format of our PDB-style files is described here.)

Timeline for d1zlac1: