Lineage for d1zglh2 (1zgl H:1-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938367Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2938411Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88822] (13 PDB entries)
    Uniprot P04229 30-219
  8. 2938428Domain d1zglh2: 1zgl H:1-92 [125042]
    Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb1, d1zgld1, d1zgld2, d1zgle1, d1zglg1, d1zglg2, d1zglh1, d1zglj1, d1zglj2, d1zglk1, d1zglp1, d1zglp2, d1zglp3, d1zglr1, d1zglr2, d1zglr3, d1zglt1, d1zglt2, d1zglt3, d1zglv1, d1zglv2, d1zglv3
    automatically matched to d1fv1b2
    fragment; missing more than one-third of the common structure and/or sequence

Details for d1zglh2

PDB Entry: 1zgl (more details), 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a
PDB Compounds: (H:) major histocompatibility complex, class II, DR beta 5

SCOPe Domain Sequences for d1zglh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zglh2 d.19.1.1 (H:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
gdtrprflqqdkyechffngtervrflhrdiynqeedlrfdsdvgeyravtelgrpdaey
wnsqkdfledrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d1zglh2:

Click to download the PDB-style file with coordinates for d1zglh2.
(The format of our PDB-style files is described here.)

Timeline for d1zglh2: