![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (7 species) |
![]() | Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries) |
![]() | Domain d1zglr2: 1zgl R:119-240 [125050] Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb1, d1zglb2, d1zgld1, d1zgld2, d1zgle1, d1zgle2, d1zglg1, d1zglg2, d1zglh1, d1zglh2, d1zglj1, d1zglj2, d1zglk1, d1zglk2, d1zglp1, d1zglp3, d1zglr1, d1zglr3, d1zglt1, d1zglt3, d1zglv1, d1zglv3 automatically matched to d1bd2e2 |
PDB Entry: 1zgl (more details), 2.8 Å
SCOPe Domain Sequences for d1zglr2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zglr2 b.1.1.2 (R:119-240) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv sa
Timeline for d1zglr2: