SCOPe 2.08: Domain d1zglg2: 1zgl G:13-81

Lineage for d1zglg2 (1zgl G:13-81)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries)

8. Domain d1zglg2: 1zgl G:13-81 [125040]
   Other proteins in same PDB: d1zgla1, d1zglb1, d1zglb2, d1zgld1, d1zgle1, d1zgle2, d1zglg1, d1zglh1, d1zglh2, d1zglj1, d1zglk1, d1zglk2, d1zglp1, d1zglp2, d1zglp3, d1zglr1, d1zglr2, d1zglr3, d1zglt1, d1zglt2, d1zglt3, d1zglv1, d1zglv2, d1zglv3
   automatically matched to d1k2da2
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1zglg2

PDB Entry: 1zgl, 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a

PDB Compounds: (G:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1zglg2:

Sequence; same for both SEQRES and ATOM records:

>d1zglg2 d.19.1.1 (G:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei
mtkrsnytp

Timeline for d1zglg2:

• d1zglg2 first appeared in SCOP 1.73
  
• d1zglg2 appears in SCOPe 2.07