SCOPe 2.08: Domain d1zglt1: 1zgl T:4-118

Lineage for d1zglt1 (1zgl T:4-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries)

8. Domain d1zglt1: 1zgl T:4-118 [125051]
   Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb1, d1zglb2, d1zgld1, d1zgld2, d1zgle1, d1zgle2, d1zglg1, d1zglg2, d1zglh1, d1zglh2, d1zglj1, d1zglj2, d1zglk1, d1zglk2, d1zglp2, d1zglp3, d1zglr2, d1zglr3, d1zglt2, d1zglt3, d1zglv2, d1zglv3
   automatically matched to d1bd2e1

Details for d1zglt1

PDB Entry: 1zgl, 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a

PDB Compounds: (T:) T cell receptor beta chain

SCOPe Domain Sequences for d1zglt1:

Sequence; same for both SEQRES and ATOM records:

>d1zglt1 b.1.1.1 (T:4-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
vtqtpryliktrgqqvtlscspisghrsvswyqqtpgqglqflfeyfnetqrnkgnfpgr
fsgrqfsnsrsemnvstlelgdsalylcassladrvnteaffgqgtrltvve

Timeline for d1zglt1:

• d1zglt1 first appeared in SCOP 1.73
  
• d1zglt1 appears in SCOPe 2.07