SCOPe 2.08: Domain d1z32x2: 1z32 X:1-408

Lineage for d1z32x2 (1z32 X:1-408)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Animal alpha-amylase [51458] (3 species)
   contains Ca2+-binding subdomain, residues 100-170

7. Species Human (Homo sapiens) [TaxId:9606] [51460] (55 PDB entries)
   Uniprot P04746 16-511 ! SQ 04746

8. Domain d1z32x2: 1z32 X:1-408 [124395]
   Other proteins in same PDB: d1z32x1
   automated match to d1jxka2
   complexed with agl, ca, cl, glc, hmc
   has additional subdomain(s) that are not in the common domain

Details for d1z32x2

PDB Entry: 1z32, 1.6 Å

PDB Description: structure-function relationships in human salivary alpha-amylase: role of aromatic residues

PDB Compounds: (X:) Salivary alpha-amylase

SCOPe Domain Sequences for d1z32x2:

Sequence; same for both SEQRES and ATOM records:

>d1z32x2 c.1.8.1 (X:1-408) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
eyssntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaihnpfrpwwe
ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
pgsrdfpavpysgwdfndgkcktgsgdienmndatqvrdcrlsglldlalgkdyvrskia
eymnhlidigvagfridaskhmwpgdikaildklhnlnsnwfpegskpfiyqevidlgge
pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwpryfengkdvndwvgp
pndngvtkevtinpdttcgndwvcehrwrqirnmvnfrnvvdgqpftn

Timeline for d1z32x2:

• d1z32x2 first appeared in SCOP 1.73
  
• d1z32x2 appears in SCOPe 2.07