SCOPe 2.08: Domain d1z32x1: 1z32 X:409-496

Lineage for d1z32x1 (1z32 X:409-496)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (55 PDB entries)
   Uniprot P04746 16-511 ! SQ 04746

8. Domain d1z32x1: 1z32 X:409-496 [124394]
   Other proteins in same PDB: d1z32x2
   automated match to d1jxka1
   complexed with agl, ca, cl, glc, hmc

Details for d1z32x1

PDB Entry: 1z32, 1.6 Å

PDB Description: structure-function relationships in human salivary alpha-amylase: role of aromatic residues

PDB Compounds: (X:) Salivary alpha-amylase

SCOPe Domain Sequences for d1z32x1:

Sequence; same for both SEQRES and ATOM records:

>d1z32x1 b.71.1.1 (X:409-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
wydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiy
vsddgkahfsisnsaedpfiaihaeskl

Timeline for d1z32x1:

• d1z32x1 first appeared in SCOP 1.73
  
• d1z32x1 appears in SCOPe 2.07