Lineage for d1z32x2 (1z32 X:1-408)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2438543Protein Animal alpha-amylase [51458] (3 species)
    contains Ca2+-binding subdomain, residues 100-170
  7. 2438544Species Human (Homo sapiens) [TaxId:9606] [51460] (55 PDB entries)
    Uniprot P04746 16-511 ! SQ 04746
  8. 2438552Domain d1z32x2: 1z32 X:1-408 [124395]
    Other proteins in same PDB: d1z32x1
    automated match to d1jxka2
    complexed with ca, cl

Details for d1z32x2

PDB Entry: 1z32 (more details), 1.6 Å

PDB Description: structure-function relationships in human salivary alpha-amylase: role of aromatic residues
PDB Compounds: (X:) Salivary alpha-amylase

SCOPe Domain Sequences for d1z32x2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z32x2 c.1.8.1 (X:1-408) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
eyssntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaihnpfrpwwe
ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
pgsrdfpavpysgwdfndgkcktgsgdienmndatqvrdcrlsglldlalgkdyvrskia
eymnhlidigvagfridaskhmwpgdikaildklhnlnsnwfpegskpfiyqevidlgge
pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwpryfengkdvndwvgp
pndngvtkevtinpdttcgndwvcehrwrqirnmvnfrnvvdgqpftn

SCOPe Domain Coordinates for d1z32x2:

Click to download the PDB-style file with coordinates for d1z32x2.
(The format of our PDB-style files is described here.)

Timeline for d1z32x2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z32x1