PDB entry 1z32

View 1z32 on RCSB PDB site
Description: Structure-function relationships in human salivary alpha-amylase: Role of aromatic residues
Class: Hydrolase
Keywords: TIM Barrel, Hydrolase
Deposited on 2005-03-10, released 2005-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.172
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Salivary alpha-amylase
    Species: Homo sapiens [TaxId:9606]
    Gene: AMY1A, AMY1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04745 (0-495)
      • modified residue (0)
      • engineered (150)
    Domains in SCOPe 2.07: d1z32x1, d1z32x2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z32X (X:)
    eyssntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaihnpfrpwwe
    ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
    pgsrdfpavpysgwdfndgkcktgsgdienmndatqvrdcrlsglldlalgkdyvrskia
    eymnhlidigvagfridaskhmwpgdikaildklhnlnsnwfpegskpfiyqevidlgge
    pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfmpsdralvfvdnhd
    nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwpryfengkdvndwvgp
    pndngvtkevtinpdttcgndwvcehrwrqirnmvnfrnvvdgqpftnwydngsnqvafg
    rgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnctgikiyvsddgkahfsis
    nsaedpfiaihaeskl