| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
| Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
| Protein Serine/threonine-protein kinase ste11 [101246] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101247] (2 PDB entries) |
| Domain d1x9xb_: 1x9x B: [121830] automated match to d1ow5a_ |
PDB Entry: 1x9x (more details)
SCOPe Domain Sequences for d1x9xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9xb_ a.60.1.2 (B:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lpfvqlfleeigctqyldsfiqcnlvteeeikyldkdilialgvnkigdrlkilrksksf
qr
Timeline for d1x9xb_: