![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
![]() | Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
![]() | Protein Serine/threonine-protein kinase ste11 [101246] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101247] (2 PDB entries) |
![]() | Domain d1ow5a_: 1ow5 A: [93630] |
PDB Entry: 1ow5 (more details)
SCOPe Domain Sequences for d1ow5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} pfvqlfleeigctqyldsfiqcnlvteeeikyldkdilialgvnkigdrlkilrksksfq
Timeline for d1ow5a_: