Lineage for d1x9xa_ (1x9x A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715476Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2715524Protein Serine/threonine-protein kinase ste11 [101246] (1 species)
  7. 2715525Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101247] (2 PDB entries)
  8. 2715527Domain d1x9xa_: 1x9x A: [121829]
    automated match to d1ow5a_

Details for d1x9xa_

PDB Entry: 1x9x (more details)

PDB Description: solution structure of dimeric sam domain from mapkkk ste11
PDB Compounds: (A:) Serine/threonine-protein kinase STE11

SCOPe Domain Sequences for d1x9xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9xa_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lpfvqlfleeigctqyldsfiqcnlvteeeikyldkdilialgvnkigdrlkilrksksf
qr

SCOPe Domain Coordinates for d1x9xa_:

Click to download the PDB-style file with coordinates for d1x9xa_.
(The format of our PDB-style files is described here.)

Timeline for d1x9xa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x9xb_