SCOP 1.73: Domain d1x9xb1: 1x9x B:91-150

Lineage for d1x9xb1 (1x9x B:91-150)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (2 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)

6. Protein Serine/threonine-protein kinase ste11 [101246] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101247] (2 PDB entries)

8. Domain d1x9xb1: 1x9x B:91-150 [121830]
   automatically matched to d1ow5a_

Details for d1x9xb1

PDB Entry: 1x9x

PDB Description: solution structure of dimeric sam domain from mapkkk ste11

PDB Compounds: (B:) Serine/threonine-protein kinase STE11

SCOP Domain Sequences for d1x9xb1:

Sequence; same for both SEQRES and ATOM records:

>d1x9xb1 a.60.1.2 (B:91-150) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfvqlfleeigctqyldsfiqcnlvteeeikyldkdilialgvnkigdrlkilrksksfq

Timeline for d1x9xb1:

• d1x9xb1 is new in SCOP 1.73
  
• d1x9xb1 appears in SCOP 1.75
  
• d1x9xb1 appears in the current release, SCOPe 2.08, called d1x9xb_