Lineage for d1ow5a_ (1ow5 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 642791Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 642823Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)
  6. 642874Protein Serine/threonine-protein kinase ste11 [101246] (1 species)
  7. 642875Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101247] (2 PDB entries)
  8. 642876Domain d1ow5a_: 1ow5 A: [93630]

Details for d1ow5a_

PDB Entry: 1ow5 (more details)

PDB Description: nmr structure of the saccharomyces cerevisiae sam (sterile alpha motif) domain
PDB Compounds: (A:) Serine/threonine-protein kinase STE11

SCOP Domain Sequences for d1ow5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ow5a_ a.60.1.2 (A:) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfvqlfleeigctqyldsfiqcnlvteeeikyldkdilialgvnkigdrlkilrksksfq

SCOP Domain Coordinates for d1ow5a_:

Click to download the PDB-style file with coordinates for d1ow5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ow5a_: