PDB entry 1x9x

View 1x9x on RCSB PDB site
Description: Solution Structure of Dimeric SAM Domain from MAPKKK Ste11
Class: transferase
Keywords: SAM domain, MAP kinase, Ste11
Deposited on 2004-08-24, released 2005-08-30
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-30, with a file datestamp of 2007-06-04.
Experiment type: NMR8
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase STE11
    Species: Saccharomyces cerevisiae
    Gene: STE11
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x9xa1
  • Chain 'B':
    Compound: Serine/threonine-protein kinase STE11
    Species: Saccharomyces cerevisiae
    Gene: STE11
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1x9xb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9xA (A:)
    dektndlpfvqlfleeigctqyldsfiqcnlvteeeikyldkdilialgvnkigdrlkil
    rksksfqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9xA (A:)
    lpfvqlfleeigctqyldsfiqcnlvteeeikyldkdilialgvnkigdrlkilrksksf
    qr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x9xB (B:)
    dektndlpfvqlfleeigctqyldsfiqcnlvteeeikyldkdilialgvnkigdrlkil
    rksksfqr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9xB (B:)
    lpfvqlfleeigctqyldsfiqcnlvteeeikyldkdilialgvnkigdrlkilrksksf
    qr