Lineage for d1x9xb1 (1x9x B:91-150)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 770823Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 770824Superfamily a.60.1: SAM/Pointed domain [47769] (3 families) (S)
  5. 770859Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (15 proteins)
  6. 770910Protein Serine/threonine-protein kinase ste11 [101246] (1 species)
  7. 770911Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101247] (2 PDB entries)
  8. 770914Domain d1x9xb1: 1x9x B:91-150 [121830]
    automatically matched to d1ow5a_

Details for d1x9xb1

PDB Entry: 1x9x (more details)

PDB Description: solution structure of dimeric sam domain from mapkkk ste11
PDB Compounds: (B:) Serine/threonine-protein kinase STE11

SCOP Domain Sequences for d1x9xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9xb1 a.60.1.2 (B:91-150) Serine/threonine-protein kinase ste11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfvqlfleeigctqyldsfiqcnlvteeeikyldkdilialgvnkigdrlkilrksksfq

SCOP Domain Coordinates for d1x9xb1:

Click to download the PDB-style file with coordinates for d1x9xb1.
(The format of our PDB-style files is described here.)

Timeline for d1x9xb1: