Lineage for d1x2ma1 (1x2m A:8-58)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691877Protein Lag1 longevity assurance homolog 6, LASS6 [140147] (1 species)
  7. 2691878Species Mouse (Mus musculus) [TaxId:10090] [140148] (1 PDB entry)
    Uniprot Q8C172 76-127
  8. 2691879Domain d1x2ma1: 1x2m A:8-58 [121645]
    Other proteins in same PDB: d1x2ma2, d1x2ma3

Details for d1x2ma1

PDB Entry: 1x2m (more details)

PDB Description: solution structure of the homeobox domain of mouse lag1 longevity assurance homolog 6
PDB Compounds: (A:) LAG1 longevity assurance homolog 6

SCOPe Domain Sequences for d1x2ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x2ma1 a.4.1.1 (A:8-58) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]}
taqpnailekvftaitkhpdekrleglskqldwdvrsiqrwfrqrrnqekp

SCOPe Domain Coordinates for d1x2ma1:

Click to download the PDB-style file with coordinates for d1x2ma1.
(The format of our PDB-style files is described here.)

Timeline for d1x2ma1: