PDB entry 1x2m

View 1x2m on RCSB PDB site
Description: Solution structure of the homeobox domain of mouse LAG1 longevity assurance homolog 6
Class: transcription
Keywords: homeobox domain, mouse LAG1 longevity assurance homolog 6, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2005-04-26, released 2005-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LAG1 longevity assurance homolog 6
    Species: Mus musculus [TaxId:10090]
    Gene: Lass6
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C172 (7-57)
      • cloning artifact (0-6)
      • cloning artifact (58-63)
    Domains in SCOPe 2.08: d1x2ma1, d1x2ma2, d1x2ma3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x2mA (A:)
    gssgssgtaqpnailekvftaitkhpdekrleglskqldwdvrsiqrwfrqrrnqekpsg
    pssg