SCOPe 2.07: Domain d1x2ma1: 1x2m A:8-58

Lineage for d1x2ma1 (1x2m A:8-58)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Lag1 longevity assurance homolog 6, LASS6 [140147] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140148] (1 PDB entry)
   Uniprot Q8C172 76-127

8. Domain d1x2ma1: 1x2m A:8-58 [121645]
   Other proteins in same PDB: d1x2ma2, d1x2ma3

Details for d1x2ma1

PDB Entry: 1x2m

PDB Description: solution structure of the homeobox domain of mouse lag1 longevity assurance homolog 6

PDB Compounds: (A:) LAG1 longevity assurance homolog 6

SCOPe Domain Sequences for d1x2ma1:

Sequence; same for both SEQRES and ATOM records:

>d1x2ma1 a.4.1.1 (A:8-58) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]}
taqpnailekvftaitkhpdekrleglskqldwdvrsiqrwfrqrrnqekp

Timeline for d1x2ma1:

• d1x2ma1 first appeared in SCOP 1.73
  
• d1x2ma1 appears in SCOPe 2.06
  
• d1x2ma1 appears in the current release, SCOPe 2.08