Lineage for d1x1yc_ (1x1y C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. Protein Barnase [81305] (1 species)
  7. Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries)
  8. Domain d1x1yc_: 1x1y C: [121612]
    Other proteins in same PDB: d1x1yd1, d1x1ye_, d1x1yf_
    automated match to d1b27a_

Details for d1x1yc_

PDB Entry: 1x1y (more details), 1.9 Å

PDB Description: Water-mediate interaction at aprotein-protein interface
PDB Compounds: (C:) Ribonuclease

SCOPe Domain Sequences for d1x1yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1yc_ d.1.1.2 (C:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir

SCOPe Domain Coordinates for d1x1yc_ are not available.

Timeline for d1x1yc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1x1ya_, d1x1yb_, d1x1yd1, d1x1ye_, d1x1yf_