| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
| Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
| Protein Barnase [81305] (1 species) |
| Species Bacillus amyloliquefaciens [TaxId:1390] [53945] (49 PDB entries) |
| Domain d1x1yb_: 1x1y B: [121611] Other proteins in same PDB: d1x1yd1, d1x1ye_, d1x1yf_ automated match to d1b27a_ |
PDB Entry: 1x1y (more details), 1.9 Å
SCOPe Domain Sequences for d1x1yb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1yb_ d.1.1.2 (B:) Barnase {Bacillus amyloliquefaciens [TaxId: 1390]}
aavintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
Timeline for d1x1yb_: