![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
![]() | Superfamily c.9.1: Barstar-related [52038] (1 family) ![]() automatically mapped to Pfam PF01337 |
![]() | Family c.9.1.1: Barstar-related [52039] (3 proteins) |
![]() | Protein automated matches [190697] (2 species) not a true protein |
![]() | Species Bacillus amyloliquefaciens [TaxId:1390] [188456] (6 PDB entries) |
![]() | Domain d1x1yf_: 1x1y F: [144575] Other proteins in same PDB: d1x1ya_, d1x1yb_, d1x1yc_, d1x1yd1 automated match to d1b27d_ |
PDB Entry: 1x1y (more details), 1.9 Å
SCOPe Domain Sequences for d1x1yf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x1yf_ c.9.1.1 (F:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]} kkavingeqirsisdlhqtlkkelalpeyygenlaalwdaltgwveyplvlewrqfeqsk qltengaesvlqvfreakaegaditiils
Timeline for d1x1yf_: