Lineage for d1x1ye_ (1x1y E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851514Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2851515Superfamily c.9.1: Barstar-related [52038] (1 family) (S)
    automatically mapped to Pfam PF01337
  5. 2851516Family c.9.1.1: Barstar-related [52039] (3 proteins)
  6. 2851555Protein automated matches [190697] (2 species)
    not a true protein
  7. 2851556Species Bacillus amyloliquefaciens [TaxId:1390] [188456] (6 PDB entries)
  8. 2851561Domain d1x1ye_: 1x1y E: [144574]
    Other proteins in same PDB: d1x1ya_, d1x1yb_, d1x1yc_, d1x1yd1
    automated match to d1b27d_

Details for d1x1ye_

PDB Entry: 1x1y (more details), 1.9 Å

PDB Description: water-mediate interaction at aprotein-protein interface
PDB Compounds: (E:) barstar

SCOPe Domain Sequences for d1x1ye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x1ye_ c.9.1.1 (E:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
kkavingeqirsisdlhqtlkkelalpeyygenlaalwdaltgwveyplvlewrqfeqsk
qltengaesvlqvfreakaegaditiils

SCOPe Domain Coordinates for d1x1ye_:

Click to download the PDB-style file with coordinates for d1x1ye_.
(The format of our PDB-style files is described here.)

Timeline for d1x1ye_: