PDB entry 1x1y

View 1x1y on RCSB PDB site
Description: Water-mediate interaction at aprotein-protein interface
Class: hydrolase/protein binding
Keywords: RNase-inhibitor complex, hydrolase/hydrolase inhibitor, HYDROLASE/PROTEIN BINDING COMPLEX
Deposited on 2005-04-15, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x1ya_
  • Chain 'B':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (0-109)
      • engineered (1)
    Domains in SCOPe 2.07: d1x1yb_
  • Chain 'C':
    Compound: Ribonuclease
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1x1yc_
  • Chain 'D':
    Compound: barstar
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11540 (0-89)
      • engineered (35)
      • engineered (40)
      • engineered (82)
    Domains in SCOPe 2.07: d1x1yd1
  • Chain 'E':
    Compound: barstar
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11540 (Start-89)
      • engineered (35)
      • engineered (40)
      • engineered (82)
    Domains in SCOPe 2.07: d1x1ye_
  • Chain 'F':
    Compound: barstar
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11540 (Start-89)
      • engineered (35)
      • engineered (40)
      • engineered (82)
    Domains in SCOPe 2.07: d1x1yf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x1yA (A:)
    aavintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1yA (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x1yB (B:)
    aavintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x1yC (C:)
    aavintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnre
    gklpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1yC (C:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x1yD (D:)
    mkkavingeqirsisdlhqtlkkelalpeyygenlaalwdaltgwveyplvlewrqfeqs
    kqltengaesvlqvfreakaegaditiils
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1x1yE (E:)
    mkkavingeqirsisdlhqtlkkelalpeyygenlaalwdaltgwveyplvlewrqfeqs
    kqltengaesvlqvfreakaegaditiils
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1yE (E:)
    kkavingeqirsisdlhqtlkkelalpeyygenlaalwdaltgwveyplvlewrqfeqsk
    qltengaesvlqvfreakaegaditiils
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1x1yF (F:)
    mkkavingeqirsisdlhqtlkkelalpeyygenlaalwdaltgwveyplvlewrqfeqs
    kqltengaesvlqvfreakaegaditiils
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x1yF (F:)
    kkavingeqirsisdlhqtlkkelalpeyygenlaalwdaltgwveyplvlewrqfeqsk
    qltengaesvlqvfreakaegaditiils