SCOPe 2.08: Domain d1wn0c_: 1wn0 C:

Lineage for d1wn0c_ (1wn0 C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)

6. Protein Histidine-containing phosphotransfer protein HP2 [140411] (1 species)

7. Species Maize (Zea mays) [TaxId:4577] [140412] (1 PDB entry)
   Uniprot Q9SLX1 9-139

8. Domain d1wn0c_: 1wn0 C: [121072]
   automated match to d1wn0a1

Details for d1wn0c_

PDB Entry: 1wn0, 2.2 Å

PDB Description: Crystal Structure of Histidine-containing Phosphotransfer Protein, ZmHP2, from maize

PDB Compounds: (C:) histidine-containing phosphotransfer protein

SCOPe Domain Sequences for d1wn0c_:

Sequence; same for both SEQRES and ATOM records:

>d1wn0c_ a.24.10.2 (C:) Histidine-containing phosphotransfer protein HP2 {Maize (Zea mays) [TaxId: 4577]}
alreqlnallssmfasglvdeqfqqlqmlqedggtpgfvaevvtlfcddadriiselaal
ldqpivdfdkvdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavvrnef
ydlrnkfqtmlqleqqiq

Timeline for d1wn0c_:

• d1wn0c_ first appeared in SCOP 1.73, called d1wn0c1
  
• d1wn0c_ appears in SCOPe 2.07