PDB entry 1wn0

View 1wn0 on RCSB PDB site
Description: Crystal Structure of Histidine-containing Phosphotransfer Protein, ZmHP2, from maize
Class: signaling protein
Keywords: four-helix bundle, SIGNALING PROTEIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-07-24, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.211
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histidine-containing phosphotransfer protein
    Species: Zea mays [TaxId:4577]
    Gene: Zmhp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wn0a1
  • Chain 'B':
    Compound: histidine-containing phosphotransfer protein
    Species: Zea mays [TaxId:4577]
    Gene: Zmhp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wn0b_
  • Chain 'C':
    Compound: histidine-containing phosphotransfer protein
    Species: Zea mays [TaxId:4577]
    Gene: Zmhp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wn0c_
  • Chain 'D':
    Compound: histidine-containing phosphotransfer protein
    Species: Zea mays [TaxId:4577]
    Gene: Zmhp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wn0d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wn0A (A:)
    maaaalreqlnallssmfasglvdeqfqqlqmlqedggtpgfvaevvtlfcddadriise
    laalldqpivdfdkvdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavv
    rnefydlrnkfqtmlqleqqiqaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wn0A (A:)
    qlnallssmfasglvdeqfqqlqmlqedggtpgfvaevvtlfcddadriiselaalldqp
    ivdfdkvdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavvrnefydlr
    nkfqtmlqleq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wn0B (B:)
    maaaalreqlnallssmfasglvdeqfqqlqmlqedggtpgfvaevvtlfcddadriise
    laalldqpivdfdkvdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavv
    rnefydlrnkfqtmlqleqqiqaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wn0B (B:)
    nallssmfasglvdeqfqqlqmlqtpgfvaevvtlfcddadriiselaalldqpivdfdk
    vdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavvrnefydlrnkfqtm
    lqle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wn0C (C:)
    maaaalreqlnallssmfasglvdeqfqqlqmlqedggtpgfvaevvtlfcddadriise
    laalldqpivdfdkvdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavv
    rnefydlrnkfqtmlqleqqiqaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wn0C (C:)
    alreqlnallssmfasglvdeqfqqlqmlqedggtpgfvaevvtlfcddadriiselaal
    ldqpivdfdkvdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavvrnef
    ydlrnkfqtmlqleqqiq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wn0D (D:)
    maaaalreqlnallssmfasglvdeqfqqlqmlqedggtpgfvaevvtlfcddadriise
    laalldqpivdfdkvdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavv
    rnefydlrnkfqtmlqleqqiqaqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wn0D (D:)
    alreqlnallssmfasglvdeqfqqlqmlqedggtpgfvaevvtlfcddadriiselaal
    ldqpivdfdkvdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavvrnef
    ydlrnkfqtmlqleqqiq