SCOP 1.73: Domain d1wn0c1: 1wn0 C:9-139

Lineage for d1wn0c1 (1wn0 C:9-139)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (5 families)
   contains additional, fifth helix at the N-terminus

5. Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)

6. Protein Histidine-containing phosphotransfer protein HP2 [140411] (1 species)

7. Species Maize (Zea mays) [TaxId:4577] [140412] (1 PDB entry)

8. Domain d1wn0c1: 1wn0 C:9-139 [121072]
   automatically matched to 1WN0 A:9-139

Details for d1wn0c1

PDB Entry: 1wn0, 2.2 Å

PDB Description: Crystal Structure of Histidine-containing Phosphotransfer Protein, ZmHP2, from maize

PDB Compounds: (C:) histidine-containing phosphotransfer protein

SCOP Domain Sequences for d1wn0c1:

Sequence; same for both SEQRES and ATOM records:

>d1wn0c1 a.24.10.2 (C:9-139) Histidine-containing phosphotransfer protein HP2 {Maize (Zea mays) [TaxId: 4577]}
qlnallssmfasglvdeqfqqlqmlqedggtpgfvaevvtlfcddadriiselaalldqp
ivdfdkvdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavvrnefydlr
nkfqtmlqleq

Timeline for d1wn0c1:

• d1wn0c1 is new in SCOP 1.73
  
• d1wn0c1 appears in SCOP 1.75
  
• d1wn0c1 appears in the current release, SCOPe 2.08, called d1wn0c_