Lineage for d1wn0d_ (1wn0 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700189Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 2700197Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)
  6. 2700204Protein Histidine-containing phosphotransfer protein HP2 [140411] (1 species)
  7. 2700205Species Maize (Zea mays) [TaxId:4577] [140412] (1 PDB entry)
    Uniprot Q9SLX1 9-139
  8. 2700209Domain d1wn0d_: 1wn0 D: [121073]
    automated match to d1wn0a1

Details for d1wn0d_

PDB Entry: 1wn0 (more details), 2.2 Å

PDB Description: Crystal Structure of Histidine-containing Phosphotransfer Protein, ZmHP2, from maize
PDB Compounds: (D:) histidine-containing phosphotransfer protein

SCOPe Domain Sequences for d1wn0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wn0d_ a.24.10.2 (D:) Histidine-containing phosphotransfer protein HP2 {Maize (Zea mays) [TaxId: 4577]}
alreqlnallssmfasglvdeqfqqlqmlqedggtpgfvaevvtlfcddadriiselaal
ldqpivdfdkvdayvhqlkgssasvgaqkvkftcmqfrqlcqdknrdgcimalavvrnef
ydlrnkfqtmlqleqqiq

SCOPe Domain Coordinates for d1wn0d_:

Click to download the PDB-style file with coordinates for d1wn0d_.
(The format of our PDB-style files is described here.)

Timeline for d1wn0d_: